New studies

Anabolic Potential of 3-hydroxybutyrate (3-OHB) and Whey Protein in a Human Catabolic Inflammatory Disease Model

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 21, 2019.

Conditions:   Endotoxemia;   Muscle Loss;   Catabolic State;   Protein; Disease;   Nutrition Therapy
Interventions:   Dietary Supplement: Whey;   Dietary Supplement: 3-OHB + Whey
Sponsors:   University of Aarhus;   Arla Foods Ingredients;   Aarhus University Hospital
Recruiting

HCV Treatment in a Low-threshold Clinic

From ClinicalTrials.gov: Recruiting Studies | Norway | First posted in the last 14 days. Published on Aug 21, 2019.

Conditions:   Hepatitis C;   Substance Use Disorders
Intervention:   Drug: Elbasvir / Grazoprevir Oral Tablet
Sponsor:   University Hospital, Akershus
Recruiting

Epigenetics and Gut Microbiota in Children With Epilepsy

From ClinicalTrials.gov: Recruiting Studies | Norway | First posted in the last 14 days. Published on Aug 20, 2019.

Condition:   Epilepsy
Intervention:   Other: Ketogenic diet
Sponsors:   Oslo University Hospital;   Norwegian University of Life Sciences;   University of Oslo;   Lund University
Recruiting

Impact of Healthy Diet on Metabolic Health in Men and Women

From ClinicalTrials.gov: Recruiting Studies | Sweden | First posted in the last 14 days. Published on Aug 20, 2019.

Conditions:   Healthy Aging;   Metabolic Syndrome;   Diet, Healthy
Interventions:   Behavioral: Healthy Diet + Physical Activity;   Behavioral: Healthy Diet
Sponsor:   Örebro University, Sweden
Recruiting

Participation in Surgical Cancer Care

From ClinicalTrials.gov: Recruiting Studies | Sweden | First posted in the last 14 days. Published on Aug 20, 2019.

Condition:   Cancer
Intervention:   Other: Participation with enhanced patient perioperative information
Sponsor:   Linkoeping University
Recruiting

1 Involvement of Dipeptidyl Peptidase-4 and Sodium-glucose Co-transporter-2 in Extrapancreatic Glucagon Secretion

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 19, 2019.

Condition:   Diabetes After Total Pancreatectomy
Interventions:   Drug: Sitagliptin 100mg;   Drug: Empagliflozin 25 MG;   Other: Placebo tablet
Sponsor:   University Hospital, Gentofte, Copenhagen
Recruiting

Glucose Metabolism in Brown Adipose Tissue (BAT) in Young Healthy Men Evaluated by Deuterium Metabolic Imaging (DMI)

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 19, 2019.

Conditions:   Type2 Diabetes;   Obesity;   Metabolic Syndrome
Interventions:   Other: cooling using a water-perfused vest;   Other: thermoneutrality
Sponsors:   University of Aarhus;   Aarhus University Hospital;   Steno Diabetes Center Copenhagen
Recruiting

Sensitivity and Specificity of Urinary Dipstick in Emergency Departments

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 16, 2019.

Condition:   Proteinuria
Intervention:   Diagnostic Test: Urinary dipstick
Sponsor:   Sonderborg Hospital
Recruiting

Dietary Protein in Proteinuria

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 16, 2019.

Conditions:   Kidney Insufficiency;   Diabete Mellitus;   Diabetes Mellitus, Type 2;   Diabetes Mellitus, Type 1;   Diabetes Complications;   Hypertension;   Glomerulonephritis;   Kidney Diseases;   Kidney Disease, Chronic
Interventions:   Other: High Animal Protein Diet;   Other: High Plant Protein Diet
Sponsors:   Jens Rikardt Andersen;   Nutricia, Inc.;   Nordsjaellands Hospital
Recruiting

Magnetic Resonance Cholangiography and Intraoperative Cholangiography in Acute Cholecystitis

From ClinicalTrials.gov: Recruiting Studies | Finland | First posted in the last 14 days. Published on Aug 16, 2019.

Condition:   Acute Cholecystitis
Interventions:   Diagnostic Test: Magnetic resonance cholangiography;   Diagnostic Test: Intraoperative cholangiography
Sponsor:   Jyväskylä Central Hospital
Recruiting

Mandibular Furcation II Regeneration

From ClinicalTrials.gov: Recruiting Studies | Norway | First posted in the last 14 days. Published on Aug 16, 2019.

Conditions:   Furcation Defects;   Periodontal Diseases
Interventions:   Device: Biphasic calcium phosphate (Straumann Bone Ceramic) + collagen membrane (Straumann Jason Membrane);   Drug: Biphasic calcium phosphate (Straumann Bone Ceramic) + enamel matrix proteins (Straumann Emdogain)
Sponsor:   University of Oslo
Recruiting

Ultrasound in Tongue Cancer- a Help to Decide Depth of Invasion and to Improve the Surgical Margin

From ClinicalTrials.gov: Recruiting Studies | Sweden | First posted in the last 14 days. Published on Aug 16, 2019.

Conditions:   Tongue Cancer;   Floor of Mouth Squamous Cell Carcinoma
Intervention:   Diagnostic Test: Ultrasound
Sponsor:   Region Örebro County
Recruiting

OptiBra Study, Optimal Postoperative Bra After Breastcancer Surgery

From ClinicalTrials.gov: Recruiting Studies | Sweden | First posted in the last 14 days. Published on Aug 16, 2019.

Conditions:   Bra;   Breast Cancer Surgery;   Complication;   Compression;   Symptoms
Intervention:   Other: OptiBra study
Sponsor:   Karolinska University Hospital
Recruiting

Clinical Predictors of Extracorporal Shockwave Therapy Efficacy in Patients Presenting With Lateral Hip Pain

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 15, 2019.

Condition:   Tendinopathy
Intervention:   Combination Product: Focused shockwave therapy
Sponsors:   Aalborg University Hospital;   University of Canberra
Recruiting

Gastro-intestinal and Hormonal Responses to Systemic Inflammatory Disease

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 14, 2019.

Conditions:   Motility Disorder;   Catabolic State;   Endotoxemia
Interventions:   Dietary Supplement: Whey;   Dietary Supplement: 3-OHB/whey
Sponsors:   University of Aarhus;   Arla Food Ingrediens;   Aarhus University Hospital
Recruiting

Sepsis at Södersjukhuset-Adherence to Treatment Guidelines

From ClinicalTrials.gov: Recruiting Studies | Sweden | First posted in the last 14 days. Published on Aug 14, 2019.

Condition:   Sepsis
Intervention:  
Sponsor:   Karolinska Institutet
Recruiting

Steroids and/ or Non-steroidal Anti-inflammatory Drugs in the Postoperative Regime After Trabeculectomy.

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 13, 2019.

Condition:   Glaucoma
Interventions:   Drug: Voltaren Ophtha 1 mg/ml, GSK;   Drug: Monopex 1 mg/ml, Théa
Sponsor:   Rigshospitalet, Denmark
Recruiting

Electronically Recorded National Early Warning Scores, Pain Scores and PONV Scores Among Hospitalized Patients

From ClinicalTrials.gov: Recruiting Studies | Finland | First posted in the last 14 days. Published on Aug 13, 2019.

Condition:   Prevention of In-hospital Adverse Events
Intervention:  
Sponsor:   Tampere University Hospital
Recruiting

Dual-hormone Closed-loop Glucose Control in Type 1 Diabetes

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 12, 2019.

Conditions:   Type 1 Diabetes;   Hypoglycemia
Interventions:   Drug: Glucagon;   Device: Closed-loop system
Sponsors:   Steno Diabetes Center Copenhagen;   Technical University of Denmark;   University of Copenhagen;   Danish Diabetes Academy
Recruiting

Dual Vaccine Trial in Myeloproliferative Neoplasms

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 09, 2019.

Conditions:   Polycythemia Vera;   Essential Thrombocythemia
Interventions:   Drug: PD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL;   Drug: Arginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
Sponsor:   Inge Marie Svane
Recruiting

Non-Pharmacological Treatment of Psychosis

From ClinicalTrials.gov: Recruiting Studies | Norway | First posted in the last 14 days. Published on Aug 09, 2019.

Condition:   Psychosis; Schizophrenia-Like
Intervention:  
Sponsor:   Haukeland University Hospital
Recruiting

DIMOH: New Digital Methods for Monitoring Oral Health. An in Vivo Assessment

From ClinicalTrials.gov: Recruiting Studies | Denmark | First posted in the last 14 days. Published on Aug 08, 2019.

Conditions:   Dental Caries;   Tooth Wear
Intervention:  
Sponsors:   University of Copenhagen;   Innovation Fund Denmark;   National and Kapodistrian University of Athens;   3Shape A/S
Recruiting

Better and Safer Return to Sport

From ClinicalTrials.gov: Recruiting Studies | Norway | First posted in the last 14 days. Published on Aug 08, 2019.

Conditions:   Anterior Cruciate Ligament Injuries;   Sport Injury
Interventions:   Other: Better and safer return to sport (BEAST);   Other: Usual care
Sponsors:   Norwegian School of Sport Sciences;   Norwegian Fund for Postgraduate Training in Physiotherapy;   International Olympic Committee;   Swedish Research Council for Sport Science;   Linkoeping University;   Karolinska Institutet
Recruiting